PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400040352
Common NameLOC102584259
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GATA
Protein Properties Length: 329aa    MW: 35876.2 Da    PI: 6.1753
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400040352genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.32.1e-18229262134
                  GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                           C++C  tkTp+WR gp g+ktLCnaCG++y++ +
  PGSC0003DMP400040352 229 CQHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 262
                           *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169928.0E-742317IPR016679Transcription factor, GATA, plant
SMARTSM004018.5E-17223273IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.556223259IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.75E-15227286No hitNo description
Gene3DG3DSA:3.30.50.105.7E-15227260IPR013088Zinc finger, NHR/GATA-type
CDDcd002024.16E-15228275No hitNo description
PROSITE patternPS003440229254IPR000679Zinc finger, GATA-type
PfamPF003205.1E-16229262IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MGSNVVDEID CGSFFDHIDD LIDFPLENEN VGLSSTDCKD FPSIWNDPLP DSDSLFSGSH  60
RNSASDLSAE LSVPYEDIVQ LEWLSTFVED SFSGGGLTLG KENIPVEKEP LSQGKFQTSS  120
PVSVLESSSS SSSSFSSSGE KTLPLSPCHR GPQRARTKRP RPTTFNPFPV FVAPGVPTES  180
ENFAESPMKK NLKPAAPEQK KKKKIKFSVP LAPVETNQNP VAQQAVRKCQ HCEITKTPQW  240
RAGPMGPKTL CNACGVRYKS GRLFPEYRPA ASPTFVPALH SNSHKKVLEM RTTIVPDNDT  300
IARTSSPAIA TQPEFNPSNN VSVEEEHK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1157161KRPRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2383420.0AC238342.1 Solanum tuberosum cultivar RH89-039-16 chromosome 5 clone RH170O21, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015163536.10.0PREDICTED: GATA transcription factor 8-like
RefseqXP_006345792.10.0PREDICTED: GATA transcription factor 8-like
RefseqXP_006345793.10.0PREDICTED: GATA transcription factor 8-like
RefseqXP_006345794.10.0PREDICTED: GATA transcription factor 8-like
RefseqXP_006345791.10.0PREDICTED: GATA transcription factor 8-like
TrEMBLM1C5120.0M1C512_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000599890.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.27e-41GATA family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]